PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c8_16720V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 491aa    MW: 54271.6 Da    PI: 7.4791
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c8_16720V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.47.6e-141560146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       +g+W +eEde+lv++v+q+G ++W++I  +  + Rt+k+c++rw +
  Pp3c8_16720V3.1.p 15 KGPWMPEEDEILVEYVRQFGARDWSSIRTKGLLPRTGKSCRLRWVN 60
                       79************************97665578**********87 PP

2Myb_DNA-binding47.63.8e-1572112345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        ++++eE++l v+  ++lG++ W++Ia++++ gRt++++k++w 
  Pp3c8_16720V3.1.p  72 KFSPEEEKLVVEMQAKLGNK-WAKIASCLP-GRTDNDVKNFWS 112
                        79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.6861066IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-191164IPR009057Homeodomain-like
SMARTSM007173.4E-111464IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-2714111IPR009057Homeodomain-like
PfamPF002491.8E-111560IPR001005SANT/Myb domain
CDDcd001671.70E-111762No hitNo description
Gene3DG3DSA:1.10.10.605.2E-1865117IPR009057Homeodomain-like
PROSITE profilePS5129416.79467119IPR017930Myb domain
SMARTSM007171.6E-1369117IPR001005SANT/Myb domain
PfamPF002492.1E-1372112IPR001005SANT/Myb domain
CDDcd001671.39E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MSLKSVQTGD EVLRKGPWMP EEDEILVEYV RQFGARDWSS IRTKGLLPRT GKSCRLRWVN  60
KLKPDLKRSG CKFSPEEEKL VVEMQAKLGN KWAKIASCLP GRTDNDVKNF WSTRQKRILR  120
ALQRPKMPSG STDASADTSD LSKDPQSTDF GGFQIHSPSG AASLIASGMG PHFIFAEGDN  180
KFRDSATDTT RCQMLHQVHT FNSMEADDVL SSHHNLSDHI PAGKTSSTPT YLTDIKTVNM  240
PTNPRTPMSS HSPFIRIFQI YDTIQNPKTG ELGLRTCEKE PCTGMTKQGA NRNPLTSLVE  300
PLASAPPCVT IASRMTRTIK QRPRSRRETR STTILSCFEH PVVETSDSGN DSNSFNSIAR  360
APQSSSPAHS SFSSQLSLTD STLPQSNSNT TSNNTSSNNN NYLEFLLQSN GSLMQNVQIF  420
SPEFPLFLTT SQQWEKLPTL YSEDASLYSG CNSKDADSCS PDSVITNFTA DVFDSLEPLN  480
SAQSEWWVAQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26131175106B-MYB
1h8a_C2e-261311725126MYB TRANSFORMING PROTEIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S114_136V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-52MYB family protein